Skip to content
TrustedSkillsbeta
Back to all skills

Alphafold Database

Listed
jimmc414·vlatest·database

Access and query jimmc414's AlphaFold protein structure prediction database for detailed structural information and analysis.

Repository

Install on your platform

Showing Claude Code. One command installs this skill into any of the agents below.

  1. 1

    Run this in your project

    terminal
    $ npx skills add jimmc414/kosmos --skill alphafold-database -a claude-code

  2. Uses the open-source skills CLI and needs Node.js. Add -g to install it for your user instead of this project.

What we know about this skill

Publisher

jimmc414

Taken from the source listing. We haven't verified who controls this account.

Install target

Live repository

Not pinned. Installing fetches whatever the repository holds at the time you run the command.

No human has reviewed this code. The checks below are a static scan of the files at one commit — nobody has run this skill or judged whether it works. A skill runs with whatever access you give your agent, so read the source before you install it.

Automated safety checks

scanned

This skill failed 3 of 6 checks. A failure is not proof of bad intent; it means something in the code needs a human to look at it before you run it.

  • No undeclared network calls: failed

    Contacts 2 hosts that are neither well-known infrastructure nor declared in the skill's frontmatter: alphafold.ebi.ac.uk, sdk.cloud.google.com.

    Every host the skill dials — from its scripts, its config endpoints or the commands it tells the agent to run — is either well-known package and API infrastructure or declared in its own frontmatter. Links in documentation are not counted.

    Hosts contacted

    alphafold.ebi.ac.ukundeclaredsdk.cloud.google.comundeclared

    What it found

    • kosmos-claude-scientific-skills/scientific-skills/alphafold-database/references/api_reference.md:39contacts alphafold.ebi.ac.uk
      curl https://alphafold.ebi.ac.uk/api/prediction/P00520
    • kosmos-claude-scientific-skills/scientific-skills/alphafold-database/references/api_reference.md:304contacts sdk.cloud.google.com
      curl https://sdk.cloud.google.com | bash

  • No obfuscated payloads: failed

    Contains 1 obfuscated or encoded payload pattern.

    No base64, hex or compressed blob is decoded and then executed, and no encoded shell commands.

    What it found

    • kosmos-claude-scientific-skills/scientific-skills/alphafold-database/references/api_reference.md:551130-character base64 literal
      "uniprotSequence": "MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEY…

  • No pipe-to-shell installers: failed

    Runs code fetched at install time in 1 place.

    No `curl … | sh` pattern, in the code or in the instructions, that runs code fetched at run time.

    What it found

    • kosmos-claude-scientific-skills/scientific-skills/alphafold-database/references/api_reference.md:304remote script piped into a shell
      curl https://sdk.cloud.google.com | bash

  • Declares what it does: passed

    SKILL.md parses and declares a name and a description.

    SKILL.md exists, its frontmatter parses, and it declares a name and a description.

  • No credential access: passed

    Reads no keys, tokens, keychains or credential files.

    Neither the code nor the SKILL.md instructions read SSH keys, cloud credentials, keychains, token stores, browser cookie databases or dotfiles that hold secrets.

  • Pinned to a commit: passed

    Scanned jimmc414/kosmos at 6cfe7f690d.

    The exact upstream commit SHA that was scanned is recorded, so the result refers to specific bytes.

Commit
6cfe7f690d
Manifest
kosmos-claude-scientific-skills/scientific-skills/alphafold-database/SKILL.md
Scanned
2 files, 857 lines
This is a static scan, not a review. It reads the skill's files; it does not run them, and it cannot tell you whether the skill is any good or whether the code does what its description says. A skill runs with whatever access you give your agent.
What each check looks for →

About this skill

What it does

This skill provides access to a database of AlphaFold protein structure predictions. It allows users to query this database, retrieve predicted structures for specific proteins, and potentially analyze structural information. The database contains a vast amount of data on protein folding, enabling research and analysis in fields like biology and drug discovery.

When to use it

  • Protein Structure Research: Investigate the predicted structure of a novel protein sequence.
  • Drug Discovery: Identify potential binding sites or targets based on protein structures.
  • Comparative Analysis: Compare the predicted structures of different proteins to understand evolutionary relationships.
  • Educational Purposes: Explore and learn about protein folding and structural biology concepts.

Key capabilities

  • Access to AlphaFold protein structure predictions database.
  • Protein sequence querying.
  • Retrieval of predicted 3D protein structures.
  • Potential for structural data analysis (specifics not detailed).

Example prompts

  • "Find the predicted structure for human insulin."
  • "What is the AlphaFold prediction for SARS-CoV-2 spike protein?"
  • “Show me the predicted structure of BRCA1.”

Tips & gotchas

The skill’s effectiveness depends on the completeness and accuracy of the underlying AlphaFold database. Results should be interpreted with caution, as they are predictions and may not perfectly reflect actual protein structures.