Skip to content
TrustedSkillsbeta
Back to all skills

Alphafold Database

Listed
ovachiever·vlatest·database

Access and query ovachiever's AlphaFold protein structure database for predictions, data, and related research findings.

Repository

Install on your platform

Showing Claude Code. One command installs this skill into any of the agents below.

  1. 1

    Run this in your project

    terminal
    $ npx skills add ovachiever/droid-tings --skill alphafold-database -a claude-code

  2. Uses the open-source skills CLI and needs Node.js. Add -g to install it for your user instead of this project.

What we know about this skill

Publisher

ovachiever

Taken from the source listing. We haven't verified who controls this account.

Install target

Live repository

Not pinned. Installing fetches whatever the repository holds at the time you run the command.

No human has reviewed this code. The checks below are a static scan of the files at one commit — nobody has run this skill or judged whether it works. A skill runs with whatever access you give your agent, so read the source before you install it.

Automated safety checks

scanned

This skill failed 3 of 6 checks. A failure is not proof of bad intent; it means something in the code needs a human to look at it before you run it.

  • No undeclared network calls: failed

    Contacts 2 hosts that are neither well-known infrastructure nor declared in the skill's frontmatter: alphafold.ebi.ac.uk, sdk.cloud.google.com.

    Every host the skill dials — from its scripts, its config endpoints or the commands it tells the agent to run — is either well-known package and API infrastructure or declared in its own frontmatter. Links in documentation are not counted.

    Hosts contacted

    alphafold.ebi.ac.ukundeclaredsdk.cloud.google.comundeclared

    What it found

    • skills/alphafold-database/references/api_reference.md:39contacts alphafold.ebi.ac.uk
      curl https://alphafold.ebi.ac.uk/api/prediction/P00520
    • skills/alphafold-database/references/api_reference.md:304contacts sdk.cloud.google.com
      curl https://sdk.cloud.google.com | bash

  • No obfuscated payloads: failed

    Contains 1 obfuscated or encoded payload pattern.

    No base64, hex or compressed blob is decoded and then executed, and no encoded shell commands.

    What it found

    • skills/alphafold-database/references/api_reference.md:551130-character base64 literal
      "uniprotSequence": "MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEY…

  • No pipe-to-shell installers: failed

    Runs code fetched at install time in 1 place.

    No `curl … | sh` pattern, in the code or in the instructions, that runs code fetched at run time.

    What it found

    • skills/alphafold-database/references/api_reference.md:304remote script piped into a shell
      curl https://sdk.cloud.google.com | bash

  • Declares what it does: passed

    SKILL.md parses and declares a name and a description.

    SKILL.md exists, its frontmatter parses, and it declares a name and a description.

  • No credential access: passed

    Reads no keys, tokens, keychains or credential files.

    Neither the code nor the SKILL.md instructions read SSH keys, cloud credentials, keychains, token stores, browser cookie databases or dotfiles that hold secrets.

  • Pinned to a commit: passed

    Scanned ovachiever/droid-tings at 7acd12a754.

    The exact upstream commit SHA that was scanned is recorded, so the result refers to specific bytes.

Commit
7acd12a754
Manifest
skills/alphafold-database/SKILL.md
Scanned
2 files, 857 lines
This is a static scan, not a review. It reads the skill's files; it does not run them, and it cannot tell you whether the skill is any good or whether the code does what its description says. A skill runs with whatever access you give your agent.
What each check looks for →

About this skill

What it does

This skill provides access to and querying capabilities of the AlphaFold Protein Structure Database. It allows users to retrieve information about protein structures, including predicted 3D coordinates, confidence scores (pLDDT), and sequence identifiers. The database contains predictions for a vast number of proteins across many species.

When to use it

  • Researching protein structure: Quickly find predicted structures for specific proteins of interest.
  • Analyzing evolutionary relationships: Compare protein sequences and structures across different organisms.
  • Drug discovery: Identify potential drug targets based on structural information.
  • Understanding disease mechanisms: Investigate how mutations affect protein structure and function.
  • Educational purposes: Explore the world of protein science and computational biology.

Key capabilities

  • Protein Structure Retrieval: Access predicted 3D structures for proteins.
  • Sequence Search: Find proteins based on their amino acid sequence.
  • Confidence Scoring (pLDDT): Retrieve pLDDT scores to assess prediction reliability.
  • Species Filtering: Limit results to specific organisms or species.

Example prompts

  • "Find the predicted structure for human hemoglobin."
  • "What is the pLDDT score for the active site of SARS-CoV-2 main protease?"
  • "Show me all proteins from E. coli with a sequence similar to ubiquitin."

Tips & gotchas

  • The AlphaFold database is vast; be as specific as possible in your queries to narrow down results.
  • pLDDT scores are crucial for assessing the reliability of predicted structures – lower scores indicate less confidence.